PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g20680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 354aa    MW: 38457.1 Da    PI: 9.0116
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g20680.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.5e-14109153347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar +  +Rt+ q+ s+ qky
  Vradi05g20680.1 109 AWTEEEHRLFLIGLQKLGKGDWRGIARNFVVTRTPTQVASHAQKY 153
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.257102158IPR017930Myb domain
SuperFamilySSF466898.22E-17104158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-18105157IPR006447Myb domain, plants
SMARTSM007173.7E-10106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-11107152IPR009057Homeodomain-like
CDDcd001675.08E-9109154No hitNo description
PfamPF002491.9E-11109153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGVGAGVKLF GVRLTDGSII KKSASMGNLN LASTHHHSSP  60
SSSNLAASSP NPSSPCSDPP HEPQGYLSDD PAHISTFANR RGERKKGVAW TEEEHRLFLI  120
GLQKLGKGDW RGIARNFVVT RTPTQVASHA QKYFIRQSHA TRRKRRSSLF DMVPDMTSDP  180
PSVPEEQVLL PPSENSQPCN GKSQPSLNLS LKSEFEPMET TSQENVEQTN ETMMGSNGLT  240
SMAPHGFFPT YLPVPFPIWP STATPFEEVK GGETSHHQVH RPIPVIAKEP VNVDELVGMS  300
HLSIGETQVR DREPSPLSLK LLGEPSRQSA FHANAPVGGS DLKTGKNKAI QAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502167.10.0PREDICTED: uncharacterized protein LOC106762661
TrEMBLA0A0L9UPN50.0A0A0L9UPN5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SFM40.0A0A0S3SFM4_PHAAN; Uncharacterized protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-105MYB_related family protein